Cart summary

You have no items in your shopping cart.

ID1 Peptide - middle region

ID1 Peptide - middle region

Catalog Number: orb2002272

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2002272
CategoryProteins
DescriptionID1 Peptide - middle region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW17kDa
UniProt IDP41134
Protein SequenceSynthetic peptide located within the following region: YDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVG
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesID1,BHLHB24, ID,
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with ID1 Rabbit Polyclonal Antibody (orb573650). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.