ID1 monoclonal antibody (M04), clone 4G11

• Catalog Number: orb2292754
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant ID1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G11
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: ID1 (AAH00613.1, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
• NCBI: AAH00613.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged ID1 is approximately 0.03 ng/ml as a capture antibody.

ID1 monoclonal antibody (M04), clone 4G11 Western Blot analysis of ID1 expression in Y-79.

Immunofluorescence of monoclonal antibody to ID1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (42.79 KDa).