You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.Coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration of 10-100 ng/ml. |
| Tag | Tag-Free |
| Expression Region | 23-114aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 10.2 kDa |
| Purity | > 98% as determined by SDS-PAGE and HPLC. |
| Protein Sequence | GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 µm filtered PBS, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ATAC, Cytokine SCM-1, Lymphotaxin, SCM-1-alpha, Small-inducible cytokine C1
Similar Products
−Human Lymphotactin (XCL1) (Active) Recombinant Protein [orb1650492]
>98% as determined by SDS-PAGE and HPLC.
10.2 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide

