You have no items in your shopping cart.
Featured
Description
Research Area
Infectious Diseases, Non-Animal
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Human immunodeficiency virus type 2 subtype A (isolate BEN) (HIV-2) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 1-113aa |
| Protein Length | Full Length |
| MW | 17.2 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MTDPRERVPPGNSGEETIGEAFEWLERTIEALNREAVNHLPRELIFQVWQRSWRYWHDEQGMSASYTKYRYLCLMQKAIFTHFKRGCTCWGEDMGREGLEDQGPPPPPPPGLV |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−vpx
Similar Products
−Human vpx protein [orb358397]
Greater than 90% as determined by SDS-PAGE.
28.8 kDa
E.coli
1 mg, 100 μg, 20 μgHuman VPX protein [orb418813]
Greater than 90% as determined by SDS-PAGE.
14.8 kDa
Yeast
100 μg, 20 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide








