You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human VP1 protein
Catalog Number: orb246116
| Catalog Number | orb246116 |
|---|---|
| Category | Proteins |
| Description | Recombinant human rhinovirus A serotype 89 Genome polyprotein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 34.6 kDa |
| UniProt ID | P07210 |
| Protein Sequence | NPVENYIDSVLNEVLVVPNIQPSTSVSSHAAPALDAAETGHTSSVQPEDMIETRYVITDQTRDETSIESFLGRSGCIAMIEFNTSSDKTEHDKIGKGFKTWKVSLQEMAQIRRKYELFTYTRFDSEITIVTAAAAQGNDSGHIVLQFMYVPPGAPVPEKRDDYTWQSGTNASVFWQEGQPYPRFTIPFMSIASAYYMFYDGYDGDSAASKYGSVVTNDMGTICVRIVTSNQKHDSNIVCRIYHKAKHIKAWCPRPPRAVAYQHTHSTNYIPSNGEATTQIKTRPDVFTVTNV |
| Protein Length | Partial |
| Source | Yeast |
| Biological Origin | Human rhinovirus A serotype 89 (strain 41467-Gallo) (HRV-89) |
| Expression Region | 575-866aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | VP1 Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human).
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human).
- Item 1 of 3
Human Major capsid protein VP1 protein [orb419142]
Greater than 85% as determined by SDS-PAGE.
45.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 3
Human Capsid VP2 protein [orb246524]
Greater than 90% as determined by SDS-PAGE.
64.8 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human Genome poly protein [orb419139]
Greater than 85% as determined by SDS-PAGE.
38.1 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human VP1 protein [orb244753]
Greater than 90% as determined by SDS-PAGE.
48.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Human VP1 protein [orb246069]
Greater than 90% as determined by SDS-PAGE.
34.6 kDa
Yeast
1 mg, 20 μg, 100 μg
