Human VEGF-D protein

Catalog Number: orb245335

Catalog Number	orb245335
Category	Proteins
Description	Human VEGF-D protein
Tag	N-terminal GST-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	40.1 kDa
UniProt ID	O43915
Protein Sequence	FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 89-205aa. Protein Length: Full Length of Mature Protein
Expression Region	89-205aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	VEGF-D,, VEGFD, FIGF Read more...
Note	For research use only
Application notes	This is GST-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	95%
MW:	14.9 kDa
Source:	Human VEGF-C, His Tag (orb257927) is expressed from human 293 cells (HEK293). It contains AA Thr 103 - Arg 227 (Accession # AAH35212.1).

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	Human cells