You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human USP7 protein
Catalog Number: orb418958
| Catalog Number | orb418958 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Ubiquitin carboxyl-terminal hydrolase 7 |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRE |
| Protein Length | Partial |
| UniProt ID | Q93009 |
| MW | 55.6 kDa |
| Application notes | Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 214-521aaSequence Info: Full Length of Mature Protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 214-521aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Deubiquitinating enzyme 7 Herpesvirus-associated u Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Anti-HAUSP / USP7 Rabbit Monoclonal Antibody [orb547672]
FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Monoclonal
Unconjugated
30 μl, 100 μl 
Recombinant Human USP7 Protein, N-His [orb2835014]
> 90% as determined by SDS-PAGE.
107.33 kDa
100 μg, 50 μg, 20 μgHuman USP7 Protein, His & GST Tag [orb2700711]
> 98%, determined by SDS-PAGE
This protein contains the amino acid sequence (Lys 208-Glu 560) of human USP7 (NP_003461.2) expressed and purified, with two additional aa (Gly & Pro) at the N-terminus and expressed from Baculovirus-Insect Cells.
100 μg, 20 μgHuman USP7 Protein, His & GST Tag [orb2700712]
> 90%, determined by SDS-PAGE
This protein contains full length of human USP7 (NP_003461.2) (Met 1-Asn 1102) was fused with the N-terminal polyhistidine-tagged GST tag at the N-terminus and expressed from Baculovirus-Insect Cells.
300 μg
