You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human UBE2D3 protein
Catalog Number: orb244615
| Catalog Number | orb244615 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Ubiquitin-conjugating enzyme E2 D3 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
| Protein Length | Full Length |
| UniProt ID | P61077 |
| MW | 32.7 kDa |
| Application notes | Full length of His-SUMO-tag and expression region is 1-147aa |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-147aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | UBE2D3 |
| Research Area | Cell Biology |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human UBE2D3 protein [orb392657]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
10 μg, 50 μg, 500 μg
Recombinant Human UBE2D3 Protein, His Tag [orb1551461]
> 95% by SDS-PAGE.
Recombinant Human UBE2D3 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Met147) of human UBE2D3 (Accession #NP_003331.1) fused with a 6��His Tag at the C-terminus.
100 μg, 50 μgHuman UBE2D3 Protein [orb429069]
Greater than 90.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 2 μg, 10 μgHuman UBC5 protein [orb107813]
HPLC, SDS-PAGE
Unconjugated
> 95% by SDS-PAGE and HPLC analyses.
17.7 kDa
10 μg, 500 μg, 100 μg
