You have no items in your shopping cart.
Featured
Description
Research Area
Signal Transduction
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 1-445aa |
| Protein Length | Full Length |
| MW | 51.9 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−TUBB2A
Similar Products
−- Item 1 of 2
β Tubulin Rabbit pAb Antibody [orb763673]
IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
β-tubulin(HRP Conjugated) Mouse mAb Antibody [orb763505]
IHC, WB
Canine, Gallus, Hamster, Human, Insect, Monkey, Mouse, Rabbit, Rat, Sheep, Yeast
Monoclonal
Unconjugated
50 μl, 100 μl - Item 1 of 1
Human TUBB2A protein [orb244611]
Greater than 90% as determined by SDS-PAGE.
65.9 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
- Item 1 of 1
Human TUBB2A Protein [orb1477780]
Greater than 85% as determined by SDS-PAGE.
56.0 kDa
E.coli
1 mg, 100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-6 weeks