Human TSPAN7 protein

Catalog Number: orb244607

Catalog Number	orb244607
Category	Proteins
Description	Recombinant human Tetraspanin-7
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	15.6 kDa
UniProt ID	P41732
Protein Sequence	RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 113-213aa. Protein Length: Partial
Expression Region	113-213aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	TSPAN7 Read more...
Note	For research use only
Application notes	Extracellular domain of His-tag and expression region is 113-223aa
Expiration Date	6 months from date of receipt.

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	14.5 kDa
Source:	Yeast

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human TSPAN7(Arg113-Met213) was fused with the C-terminal His Tag and expressed in Mammalian cells.