You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TSLP protein
Catalog Number: orb358943
| Catalog Number | orb358943 |
|---|---|
| Category | Proteins |
| Description | Recombinant human TSLP protein |
| Tag | N-terminal 6xHis-Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q969D9 |
| MW | 18.9 kDa |
| Application notes | Full length of HIS-tag and expression region is 18.51kDa |
| Endotoxins | Not test. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 29-159aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Thymic stromal lymphopoietin, Thymic stromal lymph Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human TSLP protein (Active) [orb359032]
> 98% as determined by SDS-PAGE and HPLC.
15.1 kDa
E.Coli
100 μg, 10 μg, 500 μg - Item 1 of 4
Recombinant human TSLP protein (R127A, R130A), C-His-Avi (HEK293) [orb1516297]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 25-38 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 4
Recombinant human TSLP protein (R127A, R130A), C-His-Avi (HEK293), Biotin conjugated [orb2328721]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 25-38 kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 3
Recombinant human TSLP protein, C-His-Avi (HEK293) [orb1516299]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 12 & 20-25 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 2
Human TSLP Protein, hFc Tag [orb1173827]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
41.1 kDa
Mammalian
10 μg, 100 μg, 50 μg
