Human Transmembrane protease serine 2 protein

SKU: orb704556

Description

This Human Transmembrane protease serine 2 protein spans the amino acid sequence from region 256-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Pharmacology & Drug Discovery

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal GST-tagged
• Expression Region: 256-492aa
• Protein Length: Partial
• MW: 53.7 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: IVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

(Serine protease 10) (PRSS10)

Quick Database Links

UniProt

O15393