You have no items in your shopping cart.
Cart summary
Human Transmembrane protease serine 2 protein
Catalog Number: orb668868
| Catalog Number | orb668868 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Transmembrane protease serine 2(TMPRSS2) protein |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 47.8 kDa |
| UniProt ID | O15393 |
| Protein Sequence | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 106-492aa. Protein Length: Partial |
| Expression Region | 106-492aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | (Serine protease 10) (PRSS10) Read more... |
| Note | For research use only |
| Application notes | Coronavirus-Host Interactome Targets Proteins |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human TMPRSS2 protein [orb358525]
Greater than 85% as determined by SDS-PAGE.
44.8 kDa
Yeast
500 μg, 20 μg, 100 μg, 1 mg Human TMPRSS2 protein [orb604423]
Greater than 90% as determined by SDS-PAGE.
46.9 kDa
E.coli
20 μg, 100 μg, 1 mgHuman TMPRSS2 protein [orb705030]
Greater than 85% as determined by SDS-PAGE.
46.9 kDa
in vitro E.coli expression system
20 μg, 100 μgHuman Transmembrane protease serine 2 protein [orb704547]
Greater than 85% as determined by SDS-PAGE.
90.6 kDa
E.coli
20 μg, 100 μg, 1 mgHuman Transmembrane protease serine 2 protein [orb704556]
Greater than 85% as determined by SDS-PAGE.
53.7 kDa
E.coli
20 μg, 100 μg, 1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars