You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human TNFSF13B protein
Catalog Number: orb245012
| Catalog Number | orb245012 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Tumor necrosis factor ligand superfamily member 13B |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL |
| Protein Length | Extracellular Domain |
| UniProt ID | Q9Y275 |
| MW | 39.7 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 68-285aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | TNFSF13B |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 5
Human TNFSF13B protein [orb705331]
Greater than 93% as determined by SDS-PAGE.
46.6 kDa
Mammalian cell
20 μg, 100 μg, 1 mg - Item 1 of 3
Human BAFF Protein, hFc Tag [orb689402]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.2 kDa after removal of the signal peptide.The apparent molecular mass of hFc-BAFF is approximately 50-55 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 4
Recombinant human TNFSF13B (Trimer) protein, N-His-Flag (HEK293) [orb1516528]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 53-60 kDa based on Tris-Bis PAGE result.
100 μg, 50 μg - Item 1 of 3
Recombinant human TNFSF13B (Trimer) protein, N-His-Avi (HEK293), Biotin conjugated [orb2328774]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 55-68 kDa based on Tris-Bis PAGE result.
20 μg, 100 μg - Item 1 of 1
Mouse BAFF Protein, hFc Tag [orb1290846]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mBAFF is approximately 40-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg
