You have no items in your shopping cart.
Cart summary
Human TNFSF13B protein
Catalog Number: orb245012
| Catalog Number | orb245012 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Tumor necrosis factor ligand superfamily member 13B |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 39.7 kDa |
| UniProt ID | Q9Y275 |
| Protein Sequence | QVAALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL |
| Protein Length | Extracellular Domain |
| Source | E.coli |
| Expression System | Expression Region: 68-285aa. Protein Length: Extracellular Domain |
| Expression Region | 68-285aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | TNFSF13B Read more... |
| Note | For research use only |
| Application notes | This is His-SUMO-tag protein |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 4
Human TNFSF13B protein [orb705331]
Greater than 93% as determined by SDS-PAGE.
46.6 kDa
Mammalian cell
20 μg, 100 μg, 1 mg Human TNFSF13B protein [orb706861]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman BAFF Protein, hFc Tag [orb689402]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.2 kDa after removal of the signal peptide.The apparent molecular mass of hFc-BAFF is approximately 50-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman TNFSF13B ELISA Kit [orb405651]
Human
0.312 ng/mL-20 ng/mL
0.078 ng/mL
10 x 96 t, 5 x 96 t, 96 t, 48 t, 24TMouse BAFF Protein, hFc Tag [orb1290846]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 46.8 kDa after removal of the signal peptide. The apparent molecular mass of hFc-mBAFF is approximately 40-55 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars