Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human TNFA protein (Active)

SKU: orb359193
ActiveBiologically Active

Description

This Human TNFA protein (Active) spans the amino acid sequence from region 87-233aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Research Area

Immunology & Inflammation

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceE.Coli
Biological OriginHomo sapiens (Human)
Biological ActivityFully biologically active when compared to standard. The ED50 as determined by a cytotoxicity assay using murine L929 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 × 10^7 IU/mg in the presence of actinomycin D.
TagTag-Free
Expression Region87-233aa
Protein LengthPartial
EndotoxinsLess than 1.0 EU/μg as determined by LAL method.
MW16.9 kDa
Purity> 98% as determined by SDS-PAGE and HPLC.
Protein SequenceMRKR+KPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized from a 0.2 μm filtered PBS, pH 7.0
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Cachectin, Tumor necrosis factor ligand superfamily member 2, TNF-a, , NTF

Similar Products

  • Human TNFA protein (Active) [orb359192]

    > 97% as determined by SDS-PAGE and HPLC.

    18.3 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
  • Human TNFA protein (Active) [orb359194]

    > 98% as determined by SDS-PAGE and HPLC.

    17.5 kDa

    E.Coli

    10 μg, 100 μg, 500 μg
  • Recombinant human TNF-Alpha protein (Active, HEK293) [orb1817200]

    >95% as determined by SDS-PAGE

    17 kDa

    10 μg, 50 μg, 500 μg
  • RecombinantTNF-α,Mouse(P.pastoris-expressed) [orb1494607]

    > 95% as analyzed by reducing SDS-PAGE.

    17kDa, observed by reducing SDS-PAGE.

    P. pastoris

    100 μg, 20 μg, 1 mg
  • Recombinant human TNF-α protein (Active, CHO) [orb3124194]

    ≥ 95% as determined by SDS-PAGE.

    17.4 kDa

    10 μg, 50 μg, 500 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Human TNFA protein (Active)

SDS-PAGE gel analysis of orb359193.

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Human TNFA protein (Active) (orb359193)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 170.00
100 μg
$ 610.00
500 μg
$ 1,330.00
DispatchUsually dispatched within 1-2 weeks
Bulk Enquiry