Human TMPRSS2 protein

SKU: orb358525

Description

This Human TMPRSS2 protein spans the amino acid sequence from region 106-492aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Protein Length: Extracellular Domain

Key Properties

• Source: Yeast
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Molecular Weight: 44.8 kDa
• Expression Region: 106-492aa
• Protein Length: Partial
• Protein Sequence: WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

D16Ertd61e protein, Epitheliasin protein, FLJ41954 protein, MGC6821 protein, PP9284 protein, PRSS10 protein, Serine protease 10 protein, TMPRSS2 protein, TMPRSS2 ERG FUSION GENE, INCLUDED protein, TMPRSS2 ETV1 FUSION GENE, INCLUDED protein, TMPS2_HUMAN protein, Transmembrane protease serine 2 catalytic chain protein, Transmembrane protease, serine 2 protein, Transmembrane protease, serine 2, EC 3.4.219 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Recombinant Human TMPRSS2 His tag protein enzyme activity is measured by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM.

Measured by Camostat Mesylate inhibit ratio on TMPRSS2, which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.03347-0.07945μM.

Quick Database Links

UniProt

O15393