Human TIMP-4 protein

Catalog Number: orb245329

Catalog Number	orb245329
Category	Proteins
Description	Recombinant human Metalloproteinase inhibitor 4
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	26.3 kDa
UniProt ID	Q99727
Protein Sequence	SCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Protein Length	Partial
Source	E.coli
Expression System	Expression Region: 31-224aa. Protein Length: Partial
Expression Region	31-224aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	TIMP-4, TIMP4 4 Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 48.6 kDa after removal of the signal peptide. The apparent molecular mass of TIMP4-hFc is approximately 55-70 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 10 μg, 100 μg, 50 μg

Recombinant Human TIMP-4 Protein, His Tag [orb1551532]
Purity:
≥90% as determined by SDS-PAGE
Source:
This protein contains the human TIMP4(Cys30-Pro224) was fused with the C-terminal His Tag and expressed in Mammalian cells.
Sizes Available: 100 μg, 50 μg
Human Metalloproteinase Inhibitor 4(C-His) protein [orb312044]
Source:
Human Cells
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	24.4 kDa
Source:	Yeast

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human TIMP4(Cys30-Pro224) was fused with the C-terminal His Tag and expressed in Mammalian cells.