Human SUMO2 Protein

SKU: orb428678

This product can be custom made

Description

Recombinant of human SUMO2 protein

Images & Validation

−

Application Notes	Recombinant & Natural Proteins

Key Properties

−

Source	Escherichia Coli
Purity	Greater than 95.0% as determined by SDS-PAGE.
Protein Sequence	MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Storage & Handling

−

Storage	Stability: Can be stored at +4C for 1 week. For long term storage , below -2°C.Please prevent freeze-thaw cycles
Form/Appearance	Sterile filtered colorless solution.
Buffer/Preservatives	The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0).
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols