Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 4-5 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human SPS1 protein
Catalog Number orb245065
Species/HostHuman
ConjugationUnconjugated
Sequence Partial
Target SPS1
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°.
Tag N-terminal GST-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence REGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALNDVS
Purity >90% as determined by SDS-PAGE.
MW 59.4 kDa
Source E.coli
Expression Region 17-302aa
Uniprot ID P19623
Product Description

Recombinant human Spermidine synthase

Application Notes
Application Notes This is GST-tag protein
Reviews
Write Your Own Review
You're reviewing:Human SPS1 protein - orb245065
Your Rating