Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1-2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human SLC4A1 protein
Catalog Number orb419054
ReactivityHuman
ConjugationUnconjugated
Sequence Partial
Target SLC4A1
Product Properties
Form/Appearance Lyophilized: Tris-based buffer, 50% glycerol
Storage Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°.
Tag N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSP
Purity >90% as determined by SDS-PAGE.
MW 65.3 kDa
Source E.coli
Expression Region 1-403aa
Uniprot ID P02730
Product Description

Recombinant Human Band 3 anion transport

Application Notes
Application Notes Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-403aa
Sequence Info: Partial
Reviews
Write Your Own Review
You're reviewing:Human SLC4A1 protein - orb419054
Your Rating