You have no items in your shopping cart.
Human SIGLEC15 protein
SKU: orb383440
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA.Immobilized Human SIGLEC15 at 5 μg/mL can bind Anti-SIGLEC15 recombinant antibody(CSB-RA761623MA3HU). The EC50 is 12.42-16.08 ng/mL. |
| Tag | N-terminal 6xHis-Myc-tagged |
| Molecular Weight | 30.7 kDa |
| Expression Region | 20-263aa |
| Protein Length | Partial |
| Protein Sequence | FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Sialic acid-binding Ig-like lectin 15; Siglec-15; CD33 antigen-like 3; SIGLEC15; CD33L3
Similar Products
−- Item 1 of 1
Human SIGLEC15 protein [orb358421]
Greater than 90% as determined by SDS-PAGE.
42.6 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
SIGLEC15 (NM_213602) Human Recombinant Protein [orb3036292]
> 80% as determined by SDS-PAGE and Coomassie blue staining
27 kDa
1 mg, 50 μg- Item 1 of 1
Human SIGLEC15 Protein, mFc-His Tag [orb689444]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.6 kDa after removal of the signal peptide.The apparent molecular mass of SIGLEC15-mFc-His is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg - Item 1 of 1
Recombinant human SIGLEC15 protein, His (HEK293) [orb1516648]
>95% as determined by SDS-PAGE
34 kDa
100 μg, 500 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human SIGLEC15 protein (orb383440)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks