You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human SIGLEC15 protein
Catalog Number: orb383440
| Catalog Number | orb383440 |
|---|---|
| Category | Proteins |
| Description | Recombinant human SIGLEC15 protein |
| Tag | N-terminal 6xHis-Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST |
| Protein Length | Partial |
| UniProt ID | Q6ZMC9 |
| MW | 30.6 kDa |
| Application notes | Baculovirus and Mammalian Cell N-terminal 6xHis-tagged and Flag-tagged Full Length |
| Endotoxins | Not test. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 20-263aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | CD33 antigen-like 3 |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human SIGLEC15 protein [orb358421]
Greater than 90% as determined by SDS-PAGE.
42.6 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 1
Human SIGLEC15 Protein, mFc-His Tag [orb689444]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 53.6 kDa after removal of the signal peptide.The apparent molecular mass of SIGLEC15-mFc-His is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 1
Recombinant human SIGLEC15 protein, His (HEK293) [orb1516648]
> 95% as determined by SDS-PAGE
34 kDa
100 μg, 500 μg 
Recombinant Human SIGLEC15/CD33L3 Protein, C-His [orb2833374]
> 90% as determined by SDS-PAGE.
29.61 kDa
100 μg, 50 μg, 20 μgRecombinant Human SIGLEC15/CD33L3 Protein, C-Fc [orb2833375]
> 90% as determined by SDS-PAGE.
54.8 kDa
100 μg, 50 μg, 20 μg
