You have no items in your shopping cart.
Cart summary
Human SERPINB9 protein
Catalog Number: orb54269
| Catalog Number | orb54269 |
|---|---|
| Category | Proteins |
| Description | Recombinant human SERPINB9 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 69.4 kDa |
| UniProt ID | P50453 |
| Protein Sequence | METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP |
| Protein Length | Full Length |
| Source | E.coli |
| Expression System | Expression Region: 1-376aa. Protein Length: Full Length |
| Expression Region | 1-376aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Cytoplasmic antiproteinase 3 Read more... |
| Note | For research use only |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-92AA: 1-376AAFull Length : Full Length |
| Expiration Date | 6 months from date of receipt. |
Human SERPINB9 protein [orb392463]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman SERPINB9 Protein (Biotin) [orb1477083]
Greater than 85% as determined by SDS-PAGE.
90.2 kDa
E.coli
20 μg, 100 μg, 1 mgRecombinant Human SERPINB9 Protein, His Tag [orb1551671]
≥90% as determined by SDS-PAGE
This protein contains the human SERPINB9(Met1-Pro376) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgSERPINB9 Recombinant Protein (Human) [orb2051869]
Greater than 90% as determined by SDS-PAGE.
69.4 kDa
E.coli
20 μgSERPINB9 Recombinant Protein (Human) [orb2051870]
Greater than 90% as determined by SDS-PAGE.
69.4 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars