Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1-2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human SEPP1 protein
Catalog Number orb244530
Species/HostHuman
ConjugationUnconjugated
Sequence Full Length of Mature Protein
Target SEPP1
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°.
Tag N-terminal 6xHis-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN
Purity >90% as determined by SDS-PAGE.
MW 44.6 kDa
Source E.coli
Expression Region 20-381aa
Uniprot ID P49908
Product Description

Recombinant human Selenoprotein P

Application Notes
Application Notes Full length of His-tag and expression region is 20-381aa
Reviews
Write Your Own Review
You're reviewing:Human SEPP1 protein - orb244530
Your Rating