Human SENP8 protein

Catalog Number: orb244884

Catalog Number	orb244884
Category	Proteins
Description	Recombinant human Sentrin-specific protease 8
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK
Protein Length	Full Length
UniProt ID	Q96LD8
MW	40.1 kDa
Application notes	This is His-SUMO-tag protein
Endotoxins	Not test.
Source	E.coli
Biological Origin	Homo sapiens (Human)
Expression Region	1-212aa
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Alternative names	SENP8
Research Area	Epigenetics & Chromatin
Note	For research use only
Expiration Date	6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	E. coli

Applications:	ELISA, WB
Purity:	Greater than 95% as determined by SDS-PAGE
MW:	23.2 kDa
Source:	E.Coli

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human SENP8(Met1-Lys212) was fused with the N-terminal His Tag and expressed in E. coli.

Purity:	Greater than 95.0% as determined by SDS-PAGE.
Source:	Escherichia Coli