Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1-2 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human SAE1 protein
Catalog Number orb54551
ReactivityHuman
ConjugationUnconjugated
Sequence Full Length
Target SAE1
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Lliquid form is at form is 6 months at -20°/-80°. Lyophilized form is 12 months at -20°/-80°.
Tag N-terminal GST-tagged
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°/-80°. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Purity >90% as determined by SDS-PAGE.
MW 65.4 kDa
Source E.coli
Expression Region 1-346aa
Uniprot ID Q9UBE0
Product Description

Recombinant human SAE1 protein

Application Notes
Application Notes N-terminal GST-tagged: N-terminal GST-tagged
1-261AA: 1-346AA
Full Length : Full Length
Reviews
Write Your Own Review
You're reviewing:Human SAE1 protein - orb54551
Your Rating