You have no items in your shopping cart.
Featured
Description
Research Area
Signal Transduction
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Expression Region | 2-105aa |
| Protein Length | Full Length of Mature Protein |
| MW | 27.6 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−S100A11
Similar Products
−- Item 1 of 1
Human S100 Calcium Binding Protein A11 (S100A11) ELISA Kit [orb1949073]
Human
0.32-20ng/mL
0.19 ng/mL
96 T, 48 T 
Recombinant Human S100A11 Protein [orb2994230]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 11.7 KDa. Observed: 12 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Human S100 Calcium Binding Protein A11 (S100A11) ELISA Kit [orb2668066]
Human
0.16-10 ng/mL
0.058 ng/mL
48 T, 96 T- Item 1 of 2
S100A11 Antibody [orb521534]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 1
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 4-5 weeks