Human S protein

• Catalog Number: orb246076
• Category: Proteins
• Description: Recombinant human coronavirus OC43 (HCoV-OC43) Spike glycoprotein
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK
• Protein Length: Partial
• UniProt ID: P36334
• MW: 39.6 kDa
• Application notes: This is His-tag protein
• Endotoxins: Not test.
• Source: Yeast
• Biological Origin: Human coronavirus OC43 (HCoV-OC43)
• Expression Region: 15-344aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: S
• Note: For research use only

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.