Human S protein

SKU: orb244697

Description

This Human S protein spans the amino acid sequence from region 15-344aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Epigenetics, Infectious Diseases, Non-Animal

Images & Validation

• Application Notes:
  This is His-SUMO-tag protein

Key Properties

• Source: E.coli
• Biological Origin: Human coronavirus OC43 (HCoV-OC43)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 15-344aa
• Protein Length: Partial
• MW: 53.6 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

S

Quick Database Links

UniProt

P36334