Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human ROPN1B protein
Catalog Number orb244498
Species/HostHuman
ConjugationUnconjugated
Target ROPN1B
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Purity >90% as determined by SDS-PAGE.
MW 41 kDa
Source E. coli
Uniprot ID Q9BZX4
Product Description

Recombinant human Ropporin-1B

Application Notes
Application Notes isoform 2 of GST-tag and expression region is 1-120aa
Reviews
Write Your Own Review
You're reviewing:Human ROPN1B protein - orb244498
Your Rating