Availability
- Request Lead Time
- In stock and ready for quick dispatch
- Usually dispatched within 4 to 5 weeks
Shipping Destination:
United StatesShipping charges:
Freight/Packing: $34.00
Product Overview
| Product Name | Human RGS7 protein |
|---|---|
| Catalog Number | orb358117 |
| Reactivity | Human |
| Conjugation | Unconjugated |
| Target | RGS7 |
Product Properties
| Form/Appearance | Tris-based buffer, 50% glycerol |
|---|---|
| Storage | Store at -20°C. for extended storage, conserve at -20°C or -80°C. |
| Note | For research use only. |
| Protein Sequence | MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTE |
| Purity | >90% as determined by SDS-PAGE. |
| MW | 60.81 kDa |
| Source | E. coli |
| Uniprot ID | P49802 |
Product Description
Recombinant human RGS7 protein
Application Notes
| Application Notes | Full length of isofrm5 of His-tag and expression region is 1-487aa |
|---|
Reviews
Write Your Own Review
