Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 4 to 5 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human RGS7 protein
Catalog Number orb358117
ReactivityHuman
ConjugationUnconjugated
Target RGS7
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGSDIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNCWEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKKRDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPTPETKPPTE
Purity >90% as determined by SDS-PAGE.
MW 60.81 kDa
Source E. coli
Uniprot ID P49802
Product Description

Recombinant human RGS7 protein

Application Notes
Application Notes Full length of isofrm5 of His-tag and expression region is 1-487aa
Reviews
Write Your Own Review
You're reviewing:Human RGS7 protein - orb358117
Your Rating