Human QKI protein

SKU: orb54422

Description

This Human QKI protein spans the amino acid sequence from region 1-341aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  N-terminal GST-tagged: N-terminal GST-tagged1-318AA: 1-341AAFull Length : Full Length

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal GST-tagged
• Molecular Weight: 64.7 kDa
• Expression Region: 1-341aa
• Protein Length: Full Length
• Protein Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

DKFZp586I0923, HKQ, Homolog of mouse quaking QKI KH domain RNA binding protein, Hqk, HQK1, HqkI, OTTHUMP00000017581, OTTHUMP00000017582, OTTHUMP00000017583, Protein quaking, QK, QK1, QK3, QKI, QKI_HUMAN, QKI1, Quaking homolog, Quaking homolog KH domain RNA binding, Quaking homolog KH domain RNA binding mouse, Quaking isoform 1, Quaking protein, RNA binding protein HQK

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q96PU8