You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 21-95aa |
| Protein Length | Full Length of Mature Protein |
| MW | 9.7 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | LLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNAS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Human PSCA Protein, hFc Tag [orb689427]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.4 kDa after removal of the signal peptide.The apparent molecular mass of PSCA-hFc is approximately 40-57 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μgMouse PSCA Protein, hFc Tag [orb1290896]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 34.5 kDa after removal of the signal peptide. The apparent molecular mass of mPSCA-hFc is approximately 40-55 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgPSCA Human Monoclonal Antibody [orb2976705]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mgPSCA Human Monoclonal Antibody [orb2976706]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].







