Human PRG2 protein

SKU: orb419260

Description

This Human PRG2 protein spans the amino acid sequence from region 106-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 106-222aaSequence Info: Full Length

Key Properties

• Source: in vitro E.coli expression system
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Molecular Weight: 29.8 kDa
• Expression Region: 106-222aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Proteoglycan 2 Cleaved into the following chain, Eosinophil granule major basic protein Short name, EMBP Short name, MBP Alternative name(s), Pregnancy-associated major basic protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P13727