You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human POP7 protein
Catalog Number: orb54345
| Catalog Number | orb54345 |
|---|---|
| Category | Proteins |
| Description | Recombinant human POP7 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK |
| Protein Length | Full Length |
| UniProt ID | O75817 |
| MW | 42.7 kDa |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-322AA: 1-140AAFull Length : Full Length |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-140aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Ribonucleases P/MRP protein subunit POP7 homolog |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 1
Human RPP20 protein [orb753648]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
15.3 kDa
E.Coli
1 mg, 200 μg, 100 μg, 50 μgHuman POP7 Protein [orb427786]
Greater than 90.0% as determined by SDS-PAGE.
Escherichia Coli
100 μg, 2 μg, 10 μg
