You have no items in your shopping cart.
Human PLA2G2D Protein
SKU: orb90226
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC |
| Purity | Greater than 95.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C |
|---|---|
| Form/Appearance | Sterile Filtered lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4. |
| Disclaimer | For research use only |
Alternative Names
−Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA(2)-IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
Similar Products
−- Item 1 of 1
Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit [orb775618]
Human
0.32-20 ng/mL
0.131 ng/mL
96 T, 48 T - Item 1 of 3
- Item 1 of 2
PLA2G2D Antibody [orb412558]
IF, WB
Human, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl, 30 μl - Item 1 of 1
Human PLA2G2D protein [orb244992]
Greater than 90% as determined by SDS-PAGE.
30.5 kDa
E.coli
20 μg, 100 μg, 1 mg Recombinant Human PLA2G2D Protein, N-His [orb2967118]
>90% as determined by SDS-PAGE.
16.85 kDa
1 mg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human PLA2G2D Protein (orb90226)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days