You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human PI3 protein
Catalog Number: orb358250
| Catalog Number | orb358250 |
|---|---|
| Category | Proteins |
| Description | Recombinant human PI3 protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P19957 |
| MW | 8 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 61-117aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | Elastase-specific inhibitor , ESIPeptidase inhibit Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) PI3.
- Item 1 of 6
Anti-MCM2 Antibody (monoclonal, 11C4) [orb654391]
FC, ICC, IF, IHC, WB
Human
Mouse
Monoclonal
Unconjugated
10 μg, 100 μg - Item 1 of 1
Human PI3 protein [orb358114]
Greater than 90% as determined by SDS-PAGE.
22 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform (PIK3CA), partial [orb1881685]
Greater than 90% as determined by SDS-PAGE.
33.9 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform (PIK3CG), partial [orb1096273]
Greater than 85% as determined by SDS-PAGE.
35.4 kDa
E.coli
20 μg, 1 mg, 100 μg - Item 1 of 1
Human PIK3R2 Protein [orb1477810]
Greater than 90% as determined by SDS-PAGE.
36.9 kDa
E.coli
1 mg, 20 μg, 100 μg
