You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245436 |
---|---|
Category | Proteins |
Description | Recombinant human Oncostatin-M |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 49 kDa |
UniProt ID | P13725 |
Protein Sequence | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSR |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 26-220aa. Protein Length: Full Length of Mature Protein |
Expression Region | 26-220aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | OSM M Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
25.8 kDa | |
Human Oncostatin M Protein, premium grade (orb257725) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Arg 252 (Accession # NP_065391.1). |
Unconjugated | |
95% | |
83.0 kDa | |
Human OSMR, His Tag (orb1496186) is expressed from human 293 cells (HEK293). It contains AA Glu 28 - Met 740 (Accession # Q99650-1). |
Unconjugated | |
90% | |
22.2 kDa | |
Human Oncostatin M (OSM) (26-221), Tag Free (orb1496309) is expressed from human 293 cells (HEK293). It contains AA Ala 26 - Arg 221 (Accession # P13725). |
Greater than 85% as determined by SDS-PAGE. | |
24.0 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
38.2 kDa | |
E.coli |
Filter by Rating