You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human NT-proBNP Protein
Catalog Number: orb1474960
| Catalog Number | orb1474960 |
|---|---|
| Category | Proteins |
| Description | N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage |
| Tag | N-terminal 6xHis |
| Reactivity | Human |
| Form/Appearance | Lyophilized at 1 mg/mL in PBS |
| Buffer/Preservatives | Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely |
| Purity | > 95% |
| Protein Sequence | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNH LQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
| MW | 12.6 KDa |
| Tested applications | ELISA, WB |
| Endotoxins | < 0.2 EU/ug |
| Source | E.coli |
| Storage | Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles |
| Alternative names | natriuretic peptide Precursor |
| Note | For research use only |
BCA to determine the quantity of the protein. SDS PAGE to determine the purity of the protein.
Human NT-ProBNP [orb2568758]
Unconjugated
≥ 95 % (via CGE under reducing conditions)
8.39 kDa
E.coli
500 μg, 1 mg, 100 μg- Item 1 of 1
Recombinant human proBNP protein, N-His (HEK293) [orb1516611]
> 90% as determined by SDS-PAGE
14 kDa
500 μg, 100 μg - Item 1 of 1
Recombinant human NT-proBNP protein, His [orb1516896]
> 95% as determined by SDS-PAGE
10 kDa
100 μg, 500 μg Recombinant Human NPPB Protein, C-Fc [orb2834362]
> 90% as determined by SDS-PAGE.
31.85 kDa
100 μg, 50 μg, 20 μg
