Human NT-proBNP Protein

• Catalog Number: orb1474960
• Category: Proteins
• Description: N-terminal pro-brain (or B-type) natriuretic peptide (NT-proBNP) is produced predominately by the cardiac ventricular myocytes. NT-proBNP is released in response to volume expansion and filling pressure and is involved in maintaining intravascular volume homeostasis. Elevated plasma levels of BNP and NT-proBNP have been observed at times of cardiac stress and damage
• Tested applications: ELISA, WB
• Reactivity: Human
• Tag: N-terminal 6xHis
• Form/Appearance: Lyophilized at 1 mg/mL in PBS
• Purity: > 95%
• MW: 12.6 KDa
• Protein Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHPLGSPGSASDLETSGLQEQRNH LQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
• Source: E.coli
• Endotoxins: < 0.2 EU/ug
• Storage: Store lyophilized protein at –20°C. Aliquot reconstituted protein and store at –80°C. Avoid repeated freezing/thawing cycles
• Buffer/Preservatives: Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely
• Alternative names: natriuretic peptide Precursor
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

BCA to determine the quantity of the protein. SDS PAGE to determine the purity of the protein.