You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human NR2F6 protein
Catalog Number: orb358787
| Catalog Number | orb358787 |
|---|---|
| Category | Proteins |
| Description | Recombinant human NR2F6 protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 59 kDa |
| UniProt ID | P10588 |
| Protein Sequence | MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ |
| Protein Length | Full Length |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-404aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | V-erbA-related protein 2 Short name, EAR-2 Read more... |
| Note | For research use only |
| Application notes | This is His-SUMO-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NR2F6.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) NR2F6.
- Item 1 of 2
Human NR2F6 protein [orb358942]
Greater than 90% as determined by SDS-PAGE.
47 kDa
Mammalian cell
1 mg, 20 μg, 100 μg - Item 1 of 1
- Item 1 of 1
Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6) [orb1674484]
Greater than 90% as determined by SDS-PAGE.
48.9 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6) [orb1674485]
Greater than 90% as determined by SDS-PAGE.
43.1 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
