Human NEDD8 protein

SKU: orb54260

Description

This Human NEDD8 protein spans the amino acid sequence from region 1-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  N-terminal GST-tagged: N-terminal GST-tagged1-345AA: 1-81AAFull Length of BC026101 : Full Length

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal GST-tagged
• Molecular Weight: 35.6 kDa
• Expression Region: 1-81aa
• Protein Length: Full Length
• Protein Sequence: MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALRGGGGLRQ
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Neddylin Neural precursor cell expressed developmentally down-regulated protein 8

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q15843