Human NAGK protein

Catalog Number: orb244981

Catalog Number	orb244981
Category	Proteins
Description	Recombinant human N-acetyl-D-glucosamine kinase
Tag	N-terminal 6xHis-SUMO-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	53.2 kDa
UniProt ID	Q9UJ70
Protein Sequence	AAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAVKIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAGEMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALGGASLGARHIGHLLPMDYSANAIAFYSYTFS
Protein Length	Full Length of Mature Protein
Source	E.coli
Expression System	Expression Region: 2-344aa. Protein Length: Full Length of Mature Protein
Expression Region	2-344aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	NAGK Read more...
Note	For research use only
Application notes	This is His-SUMO-tag protein
Expiration Date	6 months from date of receipt.

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human NAGK(Ala2-Ser344) was fused with the C-terminal His Tag and expressed in E. coli.

Applications:	ELISA, WB
Purity:	Greater than 95% as determined by SDS-PAGE
MW:	37.7 kDa
Source:	E.Coli