Human MTOR protein

SKU: orb705278

Description

This Human MTOR protein spans the amino acid sequence from region 2012-2144aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cell Biology

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Expression Region: 2012-2144aa
• Protein Length: Partial
• MW: 23.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTY

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

dJ576K7.1 (FK506 binding protein 12 rapamycin associated protein 1), FK506 binding protein 12 rapamycin associated protein 1, FK506 binding protein 12 rapamycin associated protein 2, FK506 binding protein 12 rapamycin complex associated protein 1, FK506-binding protein 12-rapamycin complex-associated protein 1, FKBP rapamycin associated protein, FKBP12 rapamycin complex associated protein, FKBP12-rapamycin complex-associated protein 1, FKBP12-rapamycin complex-associated protein, FLJ44809, FRAP, FRAP1, FRAP2

Quick Database Links

UniProt

P42345