You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human MKI67 protein
Catalog Number: orb246392
| Catalog Number | orb246392 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Antigen KI-67 |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 19.4 kDa |
| UniProt ID | P46013 |
| Protein Sequence | NEKKPMKTSPEMDIQNPDDGARKPIPRDKVTENKRCLRSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 3120-3256aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | MKI67 Read more... |
| Note | For research use only |
| Application notes | Partial of His-SUMO-tag and expression region is 2891-3256aa |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Human MKI67 protein [orb358416]
Greater than 90% as determined by SDS-PAGE.
72.1 kDa
E.coli
100 μg, 20 μg, 1 mg - Item 1 of 3
Human KI67(1206-1238) Protein, hFc Tag [orb2321449]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 29.8 kDa after removal of the signal peptide. The apparent molecular mass of KI67(1206-1238)-hFc is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 3
- Item 1 of 1
- Item 1 of 1
Human MKI67 protein [orb382959]
Greater than 90% as determined by SDS-PAGE.
56.6 kDa
E.coli
20 μg, 100 μg, 1 mg
