Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human MIF (Active) protein
Catalog Number orb427104
ReactivityHuman
ConjugationUnconjugated
Target MIF (Active)
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA.
Purity >97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Source Escherichia Coli.
Activity Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.
Product Description

Recombinant of human MIF (Active) protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18MΩ-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Reviews
Write Your Own Review
You're reviewing:Human MIF (Active) protein - orb427104
Your Rating