Human LY6H protein

Catalog Number: orb358723

Catalog Number	orb358723
Category	Proteins
Description	Recombinant human LY6H protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	11.9 kDa
UniProt ID	O94772
Protein Sequence	LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAG
Protein Length	Full Length of Mature Protein
Source	Yeast
Expression System	Expression Region: 26-115aa. Protein Length: Full Length of Mature Protein
Expression Region	26-115aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Short name, Ly-6H Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Conjugation:	Unconjugated
Purity:	The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
MW:	The protein has a predicted molecular mass of 36.0 kDa after removal of the signal peptide. The apparent molecular mass of LY6H-hFc is approximately 35-55 kDa due to glycosylation.
Source:	Mammalian

Sizes Available: 100 μg, 50 μg, 10 μg

Recombinant Human LY6H Protein, His Tag [orb1552060]
Purity:
≥90% as determined by SDS-PAGE
Source:
This protein contains the human LY6H(Leu26-Gly115) was fused with the C-terminal His Tag and expressed in Mammalian cells.
Sizes Available: 100 μg, 50 μg
Human LY6H protein (C-His) [orb311880]
Source:
Human Cells
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg
LY6H Protein, Human, Recombinant (His) [orb1961590]
Purity:
98.00%
MW:
18 KDa, reducing conditions
Sizes Available: 1 mg, 500 μg, 50 μg, 10 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human LY6H(Leu26-Gly115) was fused with the C-terminal His Tag and expressed in Mammalian cells.

Purity:	98.00%
MW:	18 KDa, reducing conditions