Human LY6G6D protein

• Catalog Number: orb419195
• Category: Proteins
• Description: Recombinant Human Lymphocyte antigen 6 complex locus G6d
• Tag: N-terminal 10xHis-B2M-JD-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
• Protein Length: Partial
• UniProt ID: O95868
• MW: 15.5 kDa
• Application notes: Tag Info: N-terminal 10xHis-B2M-JD-taggedExpression Region: 10-104aaSequence Info: Full Length of Mature Protein
• Endotoxins: Not test.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Expression Region: 10-104aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Megakaryocyte-enhanced gene transcript 1 protein
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.