Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human LRBA protein
Catalog Number orb244354
Species/HostHuman
ConjugationUnconjugated
Target LRBA
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence ASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEVSNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKKSIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDKGRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMDPVNNINVDKDKP
Purity >90% as determined by SDS-PAGE.
MW 31.7 kDa
Source E. coli
Uniprot ID P50851
Product Description

Recombinant human Lipopolysaccharide-responsive and beige-like anchor protein

Application Notes
Application Notes Partial of the full length of 2-2863aa of His-tag and expression region is 1-251aa
Reviews
Write Your Own Review
You're reviewing:Human LRBA protein - orb244354
Your Rating