Human LILRA5 protein

Catalog Number: orb244347

Catalog Number	orb244347
Category	Proteins
Description	Recombinant human Leukocyte immunoglobulin-like receptor subfamily A member 5
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	29.2 kDa
UniProt ID	A6NI73
Protein Sequence	GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
Protein Length	Extracellular Domain
Source	E.coli
Expression System	Expression Region: 42-268aa. Protein Length: Extracellular Domain
Expression Region	42-268aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	LILRA5 Read more...
Note	For research use only
Application notes	Extracellular domain of His-tag and expression region is 42-268aa
Expiration Date	6 months from date of receipt.

Purity:	> 95% by SDS-PAGE.
Source:	KMP1883, Recombinant Human LILRA5/CD85f Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Gly42-Arg268) of Human LILRA5 (Accession #NP_067073.1) fused with an 6×His Tag at the C-terminus.

Sizes Available: 50 μg, 100 μg

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human LILRA5(Met1-Arg268) was fused with the C-terminal His Tag and expressed in Mammalian cells.