Human JAM2 protein

Catalog Number: orb245892

Catalog Number	orb245892
Category	Proteins
Description	Recombinant human Junctional adhesion molecule B
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	25.5 kDa
UniProt ID	P57087
Protein Sequence	FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
Protein Length	Extracellular Domain
Source	Yeast
Expression System	Expression Region: 29-238aa. Protein Length: Extracellular Domain
Expression Region	29-238aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	JAM2 C21orf43 VEJAM UNQ219, PRO245 Read more...
Note	For research use only
Application notes	This is His-tag protein
Expiration Date	6 months from date of receipt.

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	27.5 kDa
Source:	E.coli

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Source:	Human cells

Purity:	≥90% as determined by SDS-PAGE
Source:	This protein contains the human JAM2(Met1-Ser238) was fused with the C-terminal His Tag and expressed in Mammalian cells.