You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
Human IL36A protein
Catalog Number: orb54522
| Catalog Number | orb54522 |
|---|---|
| Category | Proteins |
| Description | Recombinant human IL36A protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 44.7 kDa |
| UniProt ID | Q9UHA7 |
| Protein Sequence | MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF |
| Protein Length | Full Length |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 1-158aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | FIL1 epsilon Interleukin-1 epsilon Read more... |
| Note | For research use only |
| Application notes | N-terminal GST-tagged: N-terminal GST-tagged1-163AA: 1-158AAFull Length : Full Length |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36A.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL36A.
- Item 1 of 1
Human IL36A protein (Active) [orb358988]
> 95% as determined by SDS-PAGE and HPLC.
17.7 kDa
E.Coli
500 μg, 10 μg, 100 μg - Item 1 of 1
Human IL36A protein (Active) [orb358991]
> 95% as determined by SDS-PAGE and HPLC.
17.1 kDa
E.Coli
10 μg, 100 μg, 500 μg - Item 1 of 1
Human IL36A Protein, hFc Tag [orb2321301]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 43.2 kDa after removal of the signal peptide. The apparent molecular mass of IL36A-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg 
Recombinant Human Interleukin-36 alpha protein(IL36A) (Active) [orb1650638]
1 mg, 10 μg, 100 μg, 250 μg, 500 μgRecombinant Human Interleukin-36 alpha protein(IL36A) (Active) [orb1650639]
10 μg, 1 mg, 100 μg, 250 μg, 500 μg
